HORDB

ID: hor005488
Uniprot ID: P01300
Protein name: Pancreatic hormone
Gene name: PPY
Organism: Sus scrofa (Pig)
Family: NPY family
Source: animal
Expression: Induced in hypoglycemia, and, in vitro, by carbocal, in fetal pancreatic cells.
Disease: NA
Comments: NA
Taxonomy: Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031841 neuropeptide Y receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: APLEPVYPGDDATPEQMAQYAAELRRYINMLTRPRY
Length: 36
Propeptide: APLEPVYPGDDATPEQMAQYAAELRRYINMLTRPRYGKRDEEDLLDLKCSSLHAAAPRELSPMGA
Signal peptide: NA
Modification: T36 Tyrosine amide
Glycosylation: NA
Mutagenesis: NA

Function: Acts as a regulator of pancreatic and gastrointestinal functions
Mechanism: May be used as a marker of the viability of xenotransplanted fetal panreatic tissue in the immediate post-transplant period.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005488_AF2.pdb

hor005488_ESM.pdb

Mass:	482222	Formula:	C186H287N51O56S2
Absent amino acids:	CFHKSW	Common amino acids:	AP
pI:	4.67	Basic residues:	4
Polar residues:	8	Hydrophobic residues:	10
Hydrophobicity:	-78.06	Boman Index:	-8256
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	65.28
Instability Index:	6552.22	Extinction Coefficient cystines:	5960
Absorbance 280nm:	170.29